SCOPe 2.08: Domain d4jzjl2: 4jzj L:114-219

Lineage for d4jzjl2 (4jzj L:114-219)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)

8. Domain d4jzjl2: 4jzj L:114-219 [240369]
   Other proteins in same PDB: d4jzja_, d4jzjb1, d4jzjh_, d4jzjl1
   automated match to d4jzjb2
   complexed with gol, nag

Details for d4jzjl2

PDB Entry: 4jzj, 2.8 Å

PDB Description: crystal structure of receptor-fab complex

PDB Compounds: (L:) Fab light chain

SCOPe Domain Sequences for d4jzjl2:

Sequence; same for both SEQRES and ATOM records:

>d4jzjl2 b.1.1.2 (L:114-219) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge

Timeline for d4jzjl2:

• d4jzjl2 first appeared in SCOPe 2.04
  
• d4jzjl2 appears in SCOPe 2.07