![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
![]() | Protein automated matches [190740] (31 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries) |
![]() | Domain d4jzjl1: 4jzj L:1-113 [240368] Other proteins in same PDB: d4jzjb2, d4jzjl2 automated match to d4jzjb1 complexed with gol, nag |
PDB Entry: 4jzj (more details), 2.8 Å
SCOPe Domain Sequences for d4jzjl1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4jzjl1 b.1.1.0 (L:1-113) automated matches {Mouse (Mus musculus) [TaxId: 10090]} divmtqspdslavslgeratincessqsllnsgnqknyltwyqqkpgqppkpliywastr esgvpdrfsgsgsgtdftltisslqaedvavyycqndysypytfgqgtkleik
Timeline for d4jzjl1:
![]() Domains from other chains: (mouse over for more information) d4jzja_, d4jzjb1, d4jzjb2, d4jzjh_ |