Lineage for d4jugl_ (4jug L:)

  1. Root: SCOPe 2.04
  2. 1708126Class h: Coiled coil proteins [57942] (7 folds)
  3. 1709414Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 1709415Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 1709416Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 1709417Protein Influenza hemagglutinin (stalk) [58066] (7 species)
    trimer
  7. 1709420Species Influenza A virus, different strains [TaxId:11320] [58067] (95 PDB entries)
  8. 1709508Domain d4jugl_: 4jug L: [240360]
    Other proteins in same PDB: d4juga_, d4jugc_, d4juge_, d4jugg_, d4jugi_, d4jugk_
    automated match to d1rd8b_
    mutant

Details for d4jugl_

PDB Entry: 4jug (more details), 2.7 Å

PDB Description: crystal structure of 1918 pandemic influenza virus hemagglutinin mutant d225g
PDB Compounds: (L:) Hemagglutinin

SCOPe Domain Sequences for d4jugl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4jugl_ h.3.1.1 (L:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]}
glfgaiagfieggwtgmidgwygyhhqneqgsgyaadqkstqnaidgitnkvnsviekmn
tqftavgkefnnlerrienlnkkvddgfldiwtynaellvllenertldfhdsnvrnlye
kvksqlknnakeigngcfefyhkcddacmesvrngtydypkysee

SCOPe Domain Coordinates for d4jugl_:

Click to download the PDB-style file with coordinates for d4jugl_.
(The format of our PDB-style files is described here.)

Timeline for d4jugl_: