Lineage for d2lal.1 (2lal A:,B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2778276Family b.29.1.1: Legume lectins [49900] (5 proteins)
  6. 2778483Protein Legume lectin [49904] (23 species)
  7. 2778523Species Common lentil (Lens culinaris) [TaxId:3864] [49906] (4 PDB entries)
    two-chain protein resulted from a single-chain precursor
  8. 2778528Domain d2lal.1: 2lal A:,B: [24036]
    complexed with ca, mn, po4

Details for d2lal.1

PDB Entry: 2lal (more details), 1.8 Å

PDB Description: crystal structure determination and refinement at 2.3 angstroms resolution of the lentil lectin
PDB Compounds: (A:) lentil lectin (alpha chain), (B:) lentil lectin (beta chain)

SCOPe Domain Sequences for d2lal.1:

Sequence; same for both SEQRES and ATOM records: (download)

>g2lal.1 b.29.1.1 (A:,B:) Legume lectin {Common lentil (Lens culinaris) [TaxId: 3864]}
tettsfsitkfspdqqnlifqgdgyttkgkltltkavkstvgralystpihiwdrdtgnv
anfvtsftfvidapssynvadgftffiapvdtkpqtgggylgvfnskeydktsqtvavef
dtfynaawdpsnkerhigidvnsiksvntkswnlqngeranvviafnaatnvltvtltyp
nXvtsytlnevvplkdvvpewvrigfsattgaefaaqevhswsfnsqlg

SCOPe Domain Coordinates for d2lal.1:

Click to download the PDB-style file with coordinates for d2lal.1.
(The format of our PDB-style files is described here.)

Timeline for d2lal.1: