Lineage for d4ju0h_ (4ju0 H:)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3040824Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 3040825Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 3040826Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 3040827Protein Influenza hemagglutinin (stalk) [58066] (22 species)
    trimer
  7. 3041028Species Influenza A virus, different strains [TaxId:11320] [58067] (150 PDB entries)
  8. 3041307Domain d4ju0h_: 4ju0 H: [240352]
    Other proteins in same PDB: d4ju0a_, d4ju0c_, d4ju0e_, d4ju0g_, d4ju0i_, d4ju0k_
    automated match to d1qfub_
    complexed with nag, sia; mutant

Details for d4ju0h_

PDB Entry: 4ju0 (more details), 2.91 Å

PDB Description: crystal structure of 2009 pandemic influenza virus hemagglutinin mutant d225e complexed with human receptor analogue lstc
PDB Compounds: (H:) Hemagglutinin

SCOPe Domain Sequences for d4ju0h_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ju0h_ h.3.1.1 (H:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]}
glfgaiagfieggwtgmvdgwygyhhqneqgsgyaadlkstqnaideitnkvnsviekmn
tqftavgkefnhlekrienlnkkvddgfldiwtynaellvllenertldyhdsnvknlye
kvrsqlknnakeigngcfefyhkcdntcmesvkngtydypky

SCOPe Domain Coordinates for d4ju0h_:

Click to download the PDB-style file with coordinates for d4ju0h_.
(The format of our PDB-style files is described here.)

Timeline for d4ju0h_: