| Class b: All beta proteins [48724] (180 folds) |
| Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) ![]() |
| Family b.29.1.1: Legume lectins [49900] (5 proteins) |
| Protein Legume lectin [49904] (23 species) |
| Species Common lentil (Lens culinaris) [TaxId:3864] [49906] (4 PDB entries) two-chain protein resulted from a single-chain precursor |
| Domain d1les.2: 1les C:,D: [24035] complexed with ca, mn |
PDB Entry: 1les (more details), 1.9 Å
SCOPe Domain Sequences for d1les.2:
Sequence; same for both SEQRES and ATOM records: (download)
>g1les.2 b.29.1.1 (C:,D:) Legume lectin {Common lentil (Lens culinaris) [TaxId: 3864]}
tettsfsitkfspdqqnlifqgdgyttkgkltltkavkstvgralystpihiwdrdtgnv
anfvtsftfvidapssynvadgftffiapvdtkpqtgggylgvfnskeydktsqtvavef
dtfynaawdpsnkerhigidvnsiksvntkswnlqngeranvviafnaatnvltvtltyp
nXvtsytlnevvplkdvvpewvrigfsattgaefaahevhswsfhsqlgh
Timeline for d1les.2:
View in 3DDomains from other chains: (mouse over for more information) d1les.1, d1les.1, d1les.1, d1les.1 |