Lineage for d1les.2 (1les C:,D:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2778276Family b.29.1.1: Legume lectins [49900] (5 proteins)
  6. 2778483Protein Legume lectin [49904] (23 species)
  7. 2778523Species Common lentil (Lens culinaris) [TaxId:3864] [49906] (4 PDB entries)
    two-chain protein resulted from a single-chain precursor
  8. 2778527Domain d1les.2: 1les C:,D: [24035]
    complexed with ca, mn

Details for d1les.2

PDB Entry: 1les (more details), 1.9 Å

PDB Description: lentil lectin complexed with sucrose
PDB Compounds: (C:) lentil lectin, (D:) lentil lectin

SCOPe Domain Sequences for d1les.2:

Sequence; same for both SEQRES and ATOM records: (download)

>g1les.2 b.29.1.1 (C:,D:) Legume lectin {Common lentil (Lens culinaris) [TaxId: 3864]}
tettsfsitkfspdqqnlifqgdgyttkgkltltkavkstvgralystpihiwdrdtgnv
anfvtsftfvidapssynvadgftffiapvdtkpqtgggylgvfnskeydktsqtvavef
dtfynaawdpsnkerhigidvnsiksvntkswnlqngeranvviafnaatnvltvtltyp
nXvtsytlnevvplkdvvpewvrigfsattgaefaahevhswsfhsqlgh

SCOPe Domain Coordinates for d1les.2:

Click to download the PDB-style file with coordinates for d1les.2.
(The format of our PDB-style files is described here.)

Timeline for d1les.2: