Lineage for d4jjta_ (4jjt A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2099098Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2099099Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2100042Family c.14.1.0: automated matches [191346] (1 protein)
    not a true family
  6. 2100043Protein automated matches [190246] (54 species)
    not a true protein
  7. 2100394Species Mycobacterium tuberculosis [TaxId:83332] [187022] (11 PDB entries)
  8. 2100404Domain d4jjta_: 4jjt A: [240343]
    automated match to d4jjtb_
    complexed with act, gol

Details for d4jjta_

PDB Entry: 4jjt (more details), 2.5 Å

PDB Description: The crystal structure of enoyl-CoA hydratase from Mycobacterium tuberculosis H37Rv
PDB Compounds: (A:) enoyl-coa hydratase

SCOPe Domain Sequences for d4jjta_:

Sequence, based on SEQRES records: (download)

>d4jjta_ c.14.1.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
dillidtdervrtltlnrpqsrnalsaalrdrffaaladaeadddidvviltgadpvfca
gldlkelagqtalpdisprwpamtkpvigaingaavtgglelalycdiliaseharfadt
harvgllptwglsvrlpqkvgiglarrmsltgdylsatdalraglvtevvahdqllptar
rvaasivgnnqnavrallasyhridesqtaaglwleacaakqfrtsgdtiaan

Sequence, based on observed residues (ATOM records): (download)

>d4jjta_ c.14.1.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
dillidtdervrtltlnrpqsrnalsaalrdrffaaladaeadddidvviltgadpvfca
gldlkelalpdisprwpamtkpvigaingaavtgglelalycdiliaseharfadtharv
gllptwglsvrlpqkvgiglarrmsltgdylsatdalraglvtevvahdqllptarrvaa
sivgnnqnavrallasyhridesqtaaglwleacaakqfrtsgdtiaan

SCOPe Domain Coordinates for d4jjta_:

Click to download the PDB-style file with coordinates for d4jjta_.
(The format of our PDB-style files is described here.)

Timeline for d4jjta_: