SCOPe 2.05: Domain d4jhlb_: 4jhl B:

Lineage for d4jhlb_ (4jhl B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.10: SGNH hydrolase [52266] (10 families)

5. Family c.23.10.0: automated matches [191588] (1 protein)
   not a true family

6. Protein automated matches [191059] (11 species)
   not a true protein

7. Species Geobacillus stearothermophilus [TaxId:1422] [236728] (7 PDB entries)

8. Domain d4jhlb_: 4jhl B: [240340]
   automated match to d4jhla_
   complexed with cl, gol

Details for d4jhlb_

PDB Entry: 4jhl, 1.7 Å

PDB Description: Crystal Structure of of Axe2, an Acetylxylan Esterase from Geobacillus stearothermophilus

PDB Compounds: (B:) acetyl xylan esterase

SCOPe Domain Sequences for d4jhlb_:

Sequence; same for both SEQRES and ATOM records:

>d4jhlb_ c.23.10.0 (B:) automated matches {Geobacillus stearothermophilus [TaxId: 1422]}
mkigsgekllfigdsitdcgrarpegegsfgalgtgyvayvvgllqavypelgirvvnkg
isgntvrdlkarweedviaqkpdwvsimigindvwrqydlpfmkekhvyldeyeatlrsl
vletkplvkgiilmtpfyiegneqdpmrrtmdqygrvvkqiaeetnslfvdtqaafnevl
ktlypaalawdrvhpsvaghmilaraflreigfewvrsr

Timeline for d4jhlb_:

• d4jhlb_ first appeared in SCOPe 2.04
  
• d4jhlb_ appears in SCOPe 2.06
  
• d4jhlb_ appears in the current release, SCOPe 2.08