Lineage for d1les.1 (1les A:,B:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 663169Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 663170Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (25 families) (S)
  5. 663171Family b.29.1.1: Legume lectins [49900] (4 proteins)
  6. 663301Protein Legume lectin [49904] (23 species)
  7. 663367Species Common lentil (Lens culinaris) [TaxId:3864] [49906] (4 PDB entries)
    two-chain protein resulted from a single-chain precursor
  8. 663372Domain d1les.1: 1les A:,B: [24034]

Details for d1les.1

PDB Entry: 1les (more details), 1.9 Å

PDB Description: lentil lectin complexed with sucrose
PDB Compounds: (A:) lentil lectin, (B:) lentil lectin

SCOP Domain Sequences for d1les.1:

Sequence; same for both SEQRES and ATOM records: (download)

>g1les.1 b.29.1.1 (A:,B:) Legume lectin {Common lentil (Lens culinaris) [TaxId: 3864]}
tettsfsitkfspdqqnlifqgdgyttkgkltltkavkstvgralystpihiwdrdtgnv
anfvtsftfvidapssynvadgftffiapvdtkpqtgggylgvfnskeydktsqtvavef
dtfynaawdpsnkerhigidvnsiksvntkswnlqngeranvviafnaatnvltvtltyp
nXvtsytlnevvplkdvvpewvrigfsattgaefaahevhswsfhsqlgh

SCOP Domain Coordinates for d1les.1:

Click to download the PDB-style file with coordinates for d1les.1.
(The format of our PDB-style files is described here.)

Timeline for d1les.1: