Lineage for d1les.1 (1les A:,B:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 12390Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
  4. 12391Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (11 families) (S)
  5. 12392Family b.29.1.1: Legume lectins [49900] (4 proteins)
  6. 12495Protein Lectin [49904] (15 species)
  7. 12496Species Common lentil (Lens culinaris) [TaxId:3864] [49906] (4 PDB entries)
  8. 12499Domain d1les.1: 1les A:,B: [24034]

Details for d1les.1

PDB Entry: 1les (more details), 1.9 Å

PDB Description: lentil lectin complexed with sucrose

SCOP Domain Sequences for d1les.1:

Sequence; same for both SEQRES and ATOM records: (download)

>g1les.1 b.29.1.1 (A:,B:) Lectin {Common lentil (Lens culinaris)}
tettsfsitkfspdqqnlifqgdgyttkgkltltkavkstvgralystpihiwdrdtgnv
anfvtsftfvidapssynvadgftffiapvdtkpqtgggylgvfnskeydktsqtvavef
dtfynaawdpsnkerhigidvnsiksvntkswnlqngeranvviafnaatnvltvtltyp
nXvtsytlnevvplkdvvpewvrigfsattgaefaahevhswsfhsqlg

SCOP Domain Coordinates for d1les.1:

Click to download the PDB-style file with coordinates for d1les.1.
(The format of our PDB-style files is described here.)

Timeline for d1les.1: