Lineage for d4jgfa_ (4jgf A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2045692Fold b.11: gamma-Crystallin-like [49694] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key
    duplication: has internal pseudo twofold symmetry
  4. 2045693Superfamily b.11.1: gamma-Crystallin-like [49695] (7 families) (S)
  5. 2045820Family b.11.1.0: automated matches [191607] (1 protein)
    not a true family
  6. 2045821Protein automated matches [191109] (11 species)
    not a true protein
  7. 2045870Species Human (Homo sapiens) [TaxId:9606] [230909] (10 PDB entries)
  8. 2045880Domain d4jgfa_: 4jgf A: [240339]
    automated match to d4jgfb_
    mutant

Details for d4jgfa_

PDB Entry: 4jgf (more details), 2.5 Å

PDB Description: Crystal Structure of the Cataract-Causing P23T gamma D-Crystallin Mutant
PDB Compounds: (A:) Gamma-crystallin D

SCOPe Domain Sequences for d4jgfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4jgfa_ b.11.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gkitlyedrgfqgrhyecssdhtnlqpylsrcnsarvdsgcwmlyeqpnysglqyflrrg
dyadhqqwmglsdsvrscrliphsgshrirlyeredyrgqmieftedcsclqdrfrfnei
hslnvlegswvlyelsnyrgrqyllmpgdyrryqdwgatnarvgslrrvid

SCOPe Domain Coordinates for d4jgfa_:

Click to download the PDB-style file with coordinates for d4jgfa_.
(The format of our PDB-style files is described here.)

Timeline for d4jgfa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4jgfb_