| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
Superfamily c.95.1: Thiolase-like [53901] (3 families) ![]() |
| Family c.95.1.0: automated matches [196908] (1 protein) not a true family |
| Protein automated matches [196909] (83 species) not a true protein |
| Species Mycobacterium tuberculosis [TaxId:1773] [196910] (13 PDB entries) |
| Domain d4jd3d2: 4jd3 D:212-353 [240338] complexed with coa, plm |
PDB Entry: 4jd3 (more details), 2.25 Å
SCOPe Domain Sequences for d4jd3d2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4jd3d2 c.95.1.0 (D:212-353) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
dildsrsslypdslhimgwdvgshglrlrlspdltnlierylandvttfldahrltkddi
gawvshpggpkvidavatslalppealeltwrslgeignlssasilhilrdtiekrppsg
saglmlamgpgfctelvllrwr
Timeline for d4jd3d2: