Lineage for d1len.2 (1len C:,D:)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 164500Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
  4. 164501Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (14 families) (S)
  5. 164502Family b.29.1.1: Legume lectins [49900] (4 proteins)
  6. 164615Protein Legume lectin [49904] (20 species)
  7. 164622Species Common lentil (Lens culinaris) [TaxId:3864] [49906] (4 PDB entries)
  8. 164624Domain d1len.2: 1len C:,D: [24033]

Details for d1len.2

PDB Entry: 1len (more details), 1.8 Å

PDB Description: refinement of two crystal forms of lentil lectin at 1.8 angstroms resolution

SCOP Domain Sequences for d1len.2:

Sequence; same for both SEQRES and ATOM records: (download)

>g1len.2 b.29.1.1 (C:,D:) Legume lectin {Common lentil (Lens culinaris)}
tettsfsitkfspdqqnlifqgdgyttkgkltltkavkstvgralystpihiwdrdtgnv
anfvtsftfvidapssynvadgftffiapvdtkpqtgggylgvfnskeydktsqtvavef
dtfynaawdpsnkerhigidvnsiksvntkswnlqngeranvviafnaatnvltvtltyp
nXvtsytlnevvplkdvvpewvrigfsattgaefaaqevhswsfnsqlg

SCOP Domain Coordinates for d1len.2:

Click to download the PDB-style file with coordinates for d1len.2.
(The format of our PDB-style files is described here.)

Timeline for d1len.2: