Lineage for d1len.1 (1len A:,B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2778276Family b.29.1.1: Legume lectins [49900] (5 proteins)
  6. 2778483Protein Legume lectin [49904] (23 species)
  7. 2778523Species Common lentil (Lens culinaris) [TaxId:3864] [49906] (4 PDB entries)
    two-chain protein resulted from a single-chain precursor
  8. 2778524Domain d1len.1: 1len A:,B: [24032]
    complexed with ca, mn, po4

Details for d1len.1

PDB Entry: 1len (more details), 1.8 Å

PDB Description: refinement of two crystal forms of lentil lectin at 1.8 angstroms resolution
PDB Compounds: (A:) lectin, (B:) lectin

SCOPe Domain Sequences for d1len.1:

Sequence; same for both SEQRES and ATOM records: (download)

>g1len.1 b.29.1.1 (A:,B:) Legume lectin {Common lentil (Lens culinaris) [TaxId: 3864]}
tettsfsitkfspdqqnlifqgdgyttkgkltltkavkstvgralystpihiwdrdtgnv
anfvtsftfvidapssynvadgftffiapvdtkpqtgggylgvfnskeydktsqtvavef
dtfynaawdpsnkerhigidvnsiksvntkswnlqngeranvviafnaatnvltvtltyp
nXvtsytlnevvplkdvvpewvrigfsattgaefaaqevhswsfnsqlg

SCOPe Domain Coordinates for d1len.1:

Click to download the PDB-style file with coordinates for d1len.1.
(The format of our PDB-style files is described here.)

Timeline for d1len.1: