![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
![]() | Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) ![]() |
![]() | Family b.29.1.1: Legume lectins [49900] (5 proteins) |
![]() | Protein Legume lectin [49904] (23 species) |
![]() | Species Common lentil (Lens culinaris) [TaxId:3864] [49906] (4 PDB entries) two-chain protein resulted from a single-chain precursor |
![]() | Domain d1len.1: 1len A:,B: [24032] complexed with ca, mn, po4 |
PDB Entry: 1len (more details), 1.8 Å
SCOPe Domain Sequences for d1len.1:
Sequence; same for both SEQRES and ATOM records: (download)
>g1len.1 b.29.1.1 (A:,B:) Legume lectin {Common lentil (Lens culinaris) [TaxId: 3864]} tettsfsitkfspdqqnlifqgdgyttkgkltltkavkstvgralystpihiwdrdtgnv anfvtsftfvidapssynvadgftffiapvdtkpqtgggylgvfnskeydktsqtvavef dtfynaawdpsnkerhigidvnsiksvntkswnlqngeranvviafnaatnvltvtltyp nXvtsytlnevvplkdvvpewvrigfsattgaefaaqevhswsfnsqlg
Timeline for d1len.1:
![]() Domains from other chains: (mouse over for more information) d1len.2, d1len.2, d1len.2, d1len.2 |