SCOPe 2.04: Domain d4jarb2: 4jar B:212-353

Lineage for d4jarb2 (4jar B:212-353)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (3 families)

5. Family c.95.1.0: automated matches [196908] (1 protein)
   not a true family

6. Protein automated matches [196909] (45 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:1773] [196910] (11 PDB entries)

8. Domain d4jarb2: 4jar B:212-353 [240317]

Details for d4jarb2

PDB Entry: 4jar, 1.98 Å

PDB Description: crystal structure of mycobacterium tuberculosis pks11 in complex with polyketide intermediates and evidence that it synthesize alkylpyrones

PDB Compounds: (B:) Alpha-pyrone synthesis polyketide synthase-like Pks11

SCOPe Domain Sequences for d4jarb2:

Sequence; same for both SEQRES and ATOM records:

>d4jarb2 c.95.1.0 (B:212-353) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
dildsrsslypdslhimgwdvgshglrlrlspdltnlierylandvttfldahrltkddi
gawvshpggpkvidavatslalppealeltwrslgeignlssasilhilrdtiekrppsg
saglmlamgpgfctelvllrwr

Timeline for d4jarb2:

• d4jarb2 is new in SCOPe 2.04-stable
  
• d4jarb2 appears in SCOPe 2.05
  
• d4jarb2 appears in the current release, SCOPe 2.08