Lineage for d4jaqd2 (4jaq D:212-353)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2916469Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2916470Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2917323Family c.95.1.0: automated matches [196908] (1 protein)
    not a true family
  6. 2917324Protein automated matches [196909] (83 species)
    not a true protein
  7. 2917865Species Mycobacterium tuberculosis [TaxId:1773] [196910] (13 PDB entries)
  8. 2917893Domain d4jaqd2: 4jaq D:212-353 [240313]
    complexed with 14v, coa, plm

Details for d4jaqd2

PDB Entry: 4jaq (more details), 1.73 Å

PDB Description: Crystal Structure of Mycobacterium tuberculosis PKS11 Reveals Intermediates in the Synthesis of Methyl-branched Alkylpyrones
PDB Compounds: (D:) Alpha-pyrone synthesis polyketide synthase-like Pks11

SCOPe Domain Sequences for d4jaqd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4jaqd2 c.95.1.0 (D:212-353) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
dildsrsslypdslhimgwdvgshglrlrlspdltnlierylandvttfldahrltkddi
gawvshpggpkvidavatslalppealeltwrslgeignlssasilhilrdtiekrppsg
saglmlamgpgfctelvllrwr

SCOPe Domain Coordinates for d4jaqd2:

Click to download the PDB-style file with coordinates for d4jaqd2.
(The format of our PDB-style files is described here.)

Timeline for d4jaqd2: