SCOP 1.75: Domain d1rin.2: 1rin C:,D:

Lineage for d1rin.2 (1rin C:,D:)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (25 families)

5. Family b.29.1.1: Legume lectins [49900] (4 proteins)

6. Protein Legume lectin [49904] (23 species)

7. Species Garden pea (Pisum sativum) [TaxId:3888] [49905] (6 PDB entries)
   two-chain protein resulted from a single-chain precursor

8. Domain d1rin.2: 1rin C:,D: [24031]
   complexed with ca, man, mn

Details for d1rin.2

PDB Entry: 1rin, 2.6 Å

PDB Description: x-ray crystal structure of a pea lectin-trimannoside complex at 2.6 angstroms resolution

PDB Compounds: (C:) pea lectin, (D:) pea lectin

SCOP Domain Sequences for d1rin.2:

Sequence; same for both SEQRES and ATOM records:

>g1rin.2 b.29.1.1 (C:,D:) Legume lectin {Garden pea (Pisum sativum) [TaxId: 3888]}
tettsflitkfspdqqnlifqgdgyttkekltltkavkntvgralysspihiwdretgnv
anfvtsftfvinapnsynvadgftffiapvdtkpqtgggylgvfnsaeydkttetvavef
dtfynaawdpsnrdrhigidvnsiksvntkswklqngeeanvviafnaatnvltvsltyp
Xvtsytlsdvvslkdvvpewvrigfsattgaeyaahevlswsfhselsgt

Timeline for d1rin.2:

• d1rin.2 first appeared (with stable ids) in SCOP 1.55
  
• d1rin.2 appears in SCOP 1.73
  
• d1rin.2 appears in SCOPe 2.01
  
• d1rin.2 appears in the current release, SCOPe 2.08