Lineage for d1rin.2 (1rin C:,D:)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 294476Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 294477Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (15 families) (S)
  5. 294478Family b.29.1.1: Legume lectins [49900] (4 proteins)
  6. 294600Protein Legume lectin [49904] (22 species)
  7. 294666Species Garden pea (Pisum sativum) [TaxId:3888] [49905] (6 PDB entries)
    two-chain protein resulted from a single-chain precursor
  8. 294678Domain d1rin.2: 1rin C:,D: [24031]
    complexed with ca, man, mn

Details for d1rin.2

PDB Entry: 1rin (more details), 2.6 Å

PDB Description: x-ray crystal structure of a pea lectin-trimannoside complex at 2.6 angstroms resolution

SCOP Domain Sequences for d1rin.2:

Sequence; same for both SEQRES and ATOM records: (download)

>g1rin.2 b.29.1.1 (C:,D:) Legume lectin {Garden pea (Pisum sativum)}
tettsflitkfspdqqnlifqgdgyttkekltltkavkntvgralysspihiwdretgnv
anfvtsftfvinapnsynvadgftffiapvdtkpqtgggylgvfnsaeydkttetvavef
dtfynaawdpsnrdrhigidvnsiksvntkswklqngeeanvviafnaatnvltvsltyp
Xvtsytlsdvvslkdvvpewvrigfsattgaeyaahevlswsfhselsgt

SCOP Domain Coordinates for d1rin.2:

Click to download the PDB-style file with coordinates for d1rin.2.
(The format of our PDB-style files is described here.)

Timeline for d1rin.2: