SCOPe 2.07: Domain d4japb2: 4jap B:212-353

Lineage for d4japb2 (4jap B:212-353)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (3 families)

5. Family c.95.1.0: automated matches [196908] (1 protein)
   not a true family

6. Protein automated matches [196909] (81 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:1773] [196910] (13 PDB entries)

8. Domain d4japb2: 4jap B:212-353 [240301]
   complexed with 14u, coa, plm

Details for d4japb2

PDB Entry: 4jap, 1.83 Å

PDB Description: Crystal Structure of Mycobacterium tuberculosis PKS11 Reveals Intermediates in the Synthesis of Methyl-branched Alkylpyrones

PDB Compounds: (B:) Alpha-pyrone synthesis polyketide synthase-like Pks11

SCOPe Domain Sequences for d4japb2:

Sequence; same for both SEQRES and ATOM records:

>d4japb2 c.95.1.0 (B:212-353) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
dildsrsslypdslhimgwdvgshglrlrlspdltnlierylandvttfldahrltkddi
gawvshpggpkvidavatslalppealeltwrslgeignlssasilhilrdtiekrppsg
saglmlamgpgfctelvllrwr

Timeline for d4japb2:

• d4japb2 first appeared in SCOPe 2.04
  
• d4japb2 appears in SCOPe 2.06
  
• d4japb2 appears in the current release, SCOPe 2.08