Lineage for d1rin.1 (1rin A:,B:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 663169Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 663170Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (25 families) (S)
  5. 663171Family b.29.1.1: Legume lectins [49900] (4 proteins)
  6. 663301Protein Legume lectin [49904] (23 species)
  7. 663427Species Garden pea (Pisum sativum) [TaxId:3888] [49905] (6 PDB entries)
    two-chain protein resulted from a single-chain precursor
  8. 663438Domain d1rin.1: 1rin A:,B: [24030]

Details for d1rin.1

PDB Entry: 1rin (more details), 2.6 Å

PDB Description: x-ray crystal structure of a pea lectin-trimannoside complex at 2.6 angstroms resolution
PDB Compounds: (A:) pea lectin, (B:) pea lectin

SCOP Domain Sequences for d1rin.1:

Sequence; same for both SEQRES and ATOM records: (download)

>g1rin.1 b.29.1.1 (A:,B:) Legume lectin {Garden pea (Pisum sativum) [TaxId: 3888]}
tettsflitkfspdqqnlifqgdgyttkekltltkavkntvgralysspihiwdretgnv
anfvtsftfvinapnsynvadgftffiapvdtkpqtgggylgvfnsaeydkttetvavef
dtfynaawdpsnrdrhigidvnsiksvntkswklqngeeanvviafnaatnvltvsltyp
Xvtsytlsdvvslkdvvpewvrigfsattgaeyaahevlswsfhsels

SCOP Domain Coordinates for d1rin.1:

Click to download the PDB-style file with coordinates for d1rin.1.
(The format of our PDB-style files is described here.)

Timeline for d1rin.1: