Class b: All beta proteins [48724] (180 folds) |
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) |
Family b.29.1.1: Legume lectins [49900] (5 proteins) |
Protein Legume lectin [49904] (23 species) |
Species Pea (Pisum sativum) [TaxId:3888] [49905] (6 PDB entries) two-chain protein resulted from a single-chain precursor |
Domain d1rin.1: 1rin A:,B: [24030] complexed with ca, man, mn |
PDB Entry: 1rin (more details), 2.6 Å
SCOPe Domain Sequences for d1rin.1:
Sequence; same for both SEQRES and ATOM records: (download)
>g1rin.1 b.29.1.1 (A:,B:) Legume lectin {Pea (Pisum sativum) [TaxId: 3888]} tettsflitkfspdqqnlifqgdgyttkekltltkavkntvgralysspihiwdretgnv anfvtsftfvinapnsynvadgftffiapvdtkpqtgggylgvfnsaeydkttetvavef dtfynaawdpsnrdrhigidvnsiksvntkswklqngeeanvviafnaatnvltvsltyp Xvtsytlsdvvslkdvvpewvrigfsattgaeyaahevlswsfhsels
Timeline for d1rin.1:
View in 3D Domains from other chains: (mouse over for more information) d1rin.2, d1rin.2, d1rin.2, d1rin.2 |