SCOPe 2.04: Domain d4j9xa_: 4j9x A:

Lineage for d4j9xa_ (4j9x A:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.21: Diaminopimelate epimerase-like [54505] (1 superfamily)
   mixed beta-sheet folds into a barrel (n=8, S=14) around the central helix

4. Superfamily d.21.1: Diaminopimelate epimerase-like [54506] (5 families)
   duplication: consists of two similar domain swapped with C-terminal strands

5. Family d.21.1.0: automated matches [191386] (1 protein)
   not a true family

6. Protein automated matches [190491] (12 species)
   not a true protein

7. Species Pseudomonas protegens [TaxId:220664] [234939] (2 PDB entries)

8. Domain d4j9xa_: 4j9x A: [240289]
   automated match to d4j9wa_
   complexed with hyp, na

Details for d4j9xa_

PDB Entry: 4j9x, 1.7 Å

PDB Description: crystal structure of the complex of a hydroxyproline epimerase (target efi-506499, pseudomonas fluorescens pf-5) with trans-4-hydroxy-l-proline

PDB Compounds: (A:) Proline racemase family protein

SCOPe Domain Sequences for d4j9xa_:

Sequence; same for both SEQRES and ATOM records:

>d4j9xa_ d.21.1.0 (A:) automated matches {Pseudomonas protegens [TaxId: 220664]}
mkkitvidshtggeptrlvidgfpdlgrgsmaerlqilerehdqwrracvleprgsdvlv
gallcqpqagdacagviffnnsgylgmcghgtiglvrslyhlgridqgvhrietpvgtve
atlhedlsvsvrnvpayryrtqvmlqlpghgkvhgdiawggnwfflisdhgqrialdnve
althytrdvrqaleaagitgaeggvidhielfaddpqadsrnfvlcpgkaydrspcgtgt
saklaclaadgklapgqawrqasvigsqfsahyekvgeqlipilrgsahisaeatllldd
sdpfvwgigs

Timeline for d4j9xa_:

• d4j9xa_ is new in SCOPe 2.04-stable
  
• d4j9xa_ appears in SCOPe 2.05
  
• d4j9xa_ appears in the current release, SCOPe 2.08