Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.21: Diaminopimelate epimerase-like [54505] (1 superfamily) mixed beta-sheet folds into a barrel (n=8, S=14) around the central helix |
Superfamily d.21.1: Diaminopimelate epimerase-like [54506] (5 families) duplication: consists of two similar domain swapped with C-terminal strands |
Family d.21.1.0: automated matches [191386] (1 protein) not a true family |
Protein automated matches [190491] (12 species) not a true protein |
Species Pseudomonas protegens [TaxId:220664] [234939] (2 PDB entries) |
Domain d4j9xa_: 4j9x A: [240289] automated match to d4j9wa_ complexed with hyp, na |
PDB Entry: 4j9x (more details), 1.7 Å
SCOPe Domain Sequences for d4j9xa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4j9xa_ d.21.1.0 (A:) automated matches {Pseudomonas protegens [TaxId: 220664]} mkkitvidshtggeptrlvidgfpdlgrgsmaerlqilerehdqwrracvleprgsdvlv gallcqpqagdacagviffnnsgylgmcghgtiglvrslyhlgridqgvhrietpvgtve atlhedlsvsvrnvpayryrtqvmlqlpghgkvhgdiawggnwfflisdhgqrialdnve althytrdvrqaleaagitgaeggvidhielfaddpqadsrnfvlcpgkaydrspcgtgt saklaclaadgklapgqawrqasvigsqfsahyekvgeqlipilrgsahisaeatllldd sdpfvwgigs
Timeline for d4j9xa_: