Lineage for d4j9xa_ (4j9x A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2939535Fold d.21: Diaminopimelate epimerase-like [54505] (1 superfamily)
    mixed beta-sheet folds into a barrel (n=8, S=14) around the central helix
  4. 2939536Superfamily d.21.1: Diaminopimelate epimerase-like [54506] (5 families) (S)
    duplication: consists of two similar domain swapped with C-terminal strands
  5. 2939665Family d.21.1.0: automated matches [191386] (1 protein)
    not a true family
  6. 2939666Protein automated matches [190491] (18 species)
    not a true protein
  7. 2939727Species Pseudomonas protegens [TaxId:220664] [234939] (2 PDB entries)
  8. 2939730Domain d4j9xa_: 4j9x A: [240289]
    automated match to d4j9wa_
    complexed with hyp, na

Details for d4j9xa_

PDB Entry: 4j9x (more details), 1.7 Å

PDB Description: crystal structure of the complex of a hydroxyproline epimerase (target efi-506499, pseudomonas fluorescens pf-5) with trans-4-hydroxy-l-proline
PDB Compounds: (A:) Proline racemase family protein

SCOPe Domain Sequences for d4j9xa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4j9xa_ d.21.1.0 (A:) automated matches {Pseudomonas protegens [TaxId: 220664]}
mkkitvidshtggeptrlvidgfpdlgrgsmaerlqilerehdqwrracvleprgsdvlv
gallcqpqagdacagviffnnsgylgmcghgtiglvrslyhlgridqgvhrietpvgtve
atlhedlsvsvrnvpayryrtqvmlqlpghgkvhgdiawggnwfflisdhgqrialdnve
althytrdvrqaleaagitgaeggvidhielfaddpqadsrnfvlcpgkaydrspcgtgt
saklaclaadgklapgqawrqasvigsqfsahyekvgeqlipilrgsahisaeatllldd
sdpfvwgigs

SCOPe Domain Coordinates for d4j9xa_:

Click to download the PDB-style file with coordinates for d4j9xa_.
(The format of our PDB-style files is described here.)

Timeline for d4j9xa_: