SCOPe 2.06: Domain d4j8tc_: 4j8t C:

Lineage for d4j8tc_ (4j8t C:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.4: NTF2-like [54427] (31 families)
   has a beta-alpha(2)-beta insertion after the main helix

5. Family d.17.4.10: PhzA/PhzB-like [102813] (4 proteins)

6. Protein Uncharacterized protein PA3332 [159977] (1 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [159978] (2 PDB entries)
   Uniprot Q9HYR3 1-129

8. Domain d4j8tc_: 4j8t C: [240287]
   automated match to d4j8ta_
   complexed with dog

Details for d4j8tc_

PDB Entry: 4j8t, 2.05 Å

PDB Description: engineered digoxigenin binder dig10.2

PDB Compounds: (C:) Engineered Digoxigenin binder protein DIG10.2

SCOPe Domain Sequences for d4j8tc_:

Sequence, based on SEQRES records:

>d4j8tc_ d.17.4.10 (C:) Uncharacterized protein PA3332 {Pseudomonas aeruginosa [TaxId: 287]}
mnakeivvhalrllengdargwcdlfhpegvleypypppgyktrfegretiwahmrlfpe
ymtirftdvqfyetadpdlaigefhgdgvhtvsggklaadyisvlrtrdgqillyrlffn
plrvl

Sequence, based on observed residues (ATOM records):

>d4j8tc_ d.17.4.10 (C:) Uncharacterized protein PA3332 {Pseudomonas aeruginosa [TaxId: 287]}
mnakeivvhalrllengdargwcdlfhpegvleypypppgyktrfegretiwahmrlfpe
ymtirftdvqfyetadpdlaigefhgdgvhklaadyisvlrtrdgqillyrlffnplrvl

Timeline for d4j8tc_:

• d4j8tc_ first appeared in SCOPe 2.04
  
• d4j8tc_ appears in SCOPe 2.05
  
• d4j8tc_ appears in SCOPe 2.07
  
• d4j8tc_ appears in the current release, SCOPe 2.08