Lineage for d4j7ad_ (4j7a D:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2150568Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2150569Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2152713Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2152714Protein automated matches [190543] (91 species)
    not a true protein
  7. 2153568Species Uncultured bacterium [TaxId:77133] [196706] (23 PDB entries)
  8. 2153573Domain d4j7ad_: 4j7a D: [240285]
    automated match to d4j7ac_

Details for d4j7ad_

PDB Entry: 4j7a (more details), 1.49 Å

PDB Description: Crystal Structure of Est25 - a Bacterial Homolog of Hormone-Sensitive Lipase from a Metagenomic Library
PDB Compounds: (D:) esterase

SCOPe Domain Sequences for d4j7ad_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4j7ad_ c.69.1.0 (D:) automated matches {Uncultured bacterium [TaxId: 77133]}
qlpgrlgdpsmslgtdprtdprlaaaltqlgladqaaeppvnansevadciaystaaeqa
wqtlfamlgsqgepsnpvdvreetikgrggneiklyihsptghtsdsdplpcvvhthggg
mviltaadanysrwrselaatglvvvgvefrnaagalgnhpfpaglhdcadaakwvasnr
ealgistlimsgesgggnlslattmlakkegwleeiagvyaqcpyisglyaskpeelpsl
lendayfldmktmgamvkpydptgenasnplawpyhasledlaglpphvisvneldplrd
eglahyrkllkagvstvgrtvhgtchaadcsfvdvipdvyfatvrdisafaysra

SCOPe Domain Coordinates for d4j7ad_:

Click to download the PDB-style file with coordinates for d4j7ad_.
(The format of our PDB-style files is described here.)

Timeline for d4j7ad_: