Lineage for d4j70f_ (4j70 F:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2594580Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2594581Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2602131Family d.153.1.0: automated matches [191393] (1 protein)
    not a true family
  6. 2602132Protein automated matches [190509] (19 species)
    not a true protein
  7. 2602159Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [226129] (16 PDB entries)
  8. 2602162Domain d4j70f_: 4j70 F: [240282]
    Other proteins in same PDB: d4j70a_, d4j70b_, d4j70c_, d4j70d_, d4j70e_, d4j70g_, d4j70h_, d4j70i_, d4j70j_, d4j70k_, d4j70l_, d4j70m_, d4j70n_, d4j70o_, d4j70p_, d4j70q_, d4j70r_, d4j70s_, d4j70u_, d4j70v_, d4j70w_, d4j70x_, d4j70y_, d4j70z_
    automated match to d1irug_
    complexed with 1kr

Details for d4j70f_

PDB Entry: 4j70 (more details), 2.8 Å

PDB Description: Yeast 20S proteasome in complex with the belactosin derivative 3e
PDB Compounds: (F:) Proteasome component C1

SCOPe Domain Sequences for d4j70f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4j70f_ d.153.1.0 (F:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gtgydlsnsvfspdgrnfqveyavkavengttsigikcndgvvfaveklitskllvpqkn
vkiqvvdrhigcvysglipdgrhlvnrgreeaasfkklyktpipipafadrlgqyvqaht
lynsvrpfgvstifggvdkngahlymlepsgsywgykgaatgkgrqsakaeleklvdhhp
eglsareavkqaakiiylahednkekdfeleiswcslsetnglhkfvkgdllqeaidfaq
kein

SCOPe Domain Coordinates for d4j70f_:

Click to download the PDB-style file with coordinates for d4j70f_.
(The format of our PDB-style files is described here.)

Timeline for d4j70f_: