| Class b: All beta proteins [48724] (177 folds) |
| Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.1: RmlC-like cupins [51182] (25 families) ![]() |
| Family b.82.1.10: TM1459-like [101976] (3 proteins) |
| Protein Hydroxypropylphosphonic acid epoxidase Fom4, C-terminal domain [141593] (1 species) |
| Species Streptomyces wedmorensis [TaxId:43759] [141594] (14 PDB entries) Uniprot Q56185 77-198 |
| Domain d4j1xc2: 4j1x C:77-198 [240280] Other proteins in same PDB: d4j1xa1, d4j1xb1, d4j1xc1 automated match to d4j1xa2 complexed with 1jj, fe2, gol |
PDB Entry: 4j1x (more details), 2.8 Å
SCOPe Domain Sequences for d4j1xc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4j1xc2 b.82.1.10 (C:77-198) Hydroxypropylphosphonic acid epoxidase Fom4, C-terminal domain {Streptomyces wedmorensis [TaxId: 43759]}
dlddgviiqmpderpilkgvrdnvdyyvynclvrtkrapslvplvvdvltdnpddakfns
ghagneflfvlegeihmkwgdkenpkeallptgasmfveehvphaftaakgtgsakliav
nf
Timeline for d4j1xc2:
View in 3DDomains from other chains: (mouse over for more information) d4j1xa1, d4j1xa2, d4j1xb1, d4j1xb2 |