SCOPe 2.05: Domain d4j1xc2: 4j1x C:77-198

Lineage for d4j1xc2 (4j1x C:77-198)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.1: RmlC-like cupins [51182] (25 families)

5. Family b.82.1.10: TM1459-like [101976] (2 proteins)

6. Protein Hydroxypropylphosphonic acid epoxidase Fom4, C-terminal domain [141593] (1 species)

7. Species Streptomyces wedmorensis [TaxId:43759] [141594] (14 PDB entries)
   Uniprot Q56185 77-198

8. Domain d4j1xc2: 4j1x C:77-198 [240280]
   Other proteins in same PDB: d4j1xa1, d4j1xb1, d4j1xc1
   automated match to d4j1xa2
   complexed with 1jj, fe2, gol

Details for d4j1xc2

PDB Entry: 4j1x, 2.8 Å

PDB Description: Crystal Structure of Fe(II)-HppE with alternative substrate (S)-1-HPP

PDB Compounds: (C:) epoxidase

SCOPe Domain Sequences for d4j1xc2:

Sequence; same for both SEQRES and ATOM records:

>d4j1xc2 b.82.1.10 (C:77-198) Hydroxypropylphosphonic acid epoxidase Fom4, C-terminal domain {Streptomyces wedmorensis [TaxId: 43759]}
dlddgviiqmpderpilkgvrdnvdyyvynclvrtkrapslvplvvdvltdnpddakfns
ghagneflfvlegeihmkwgdkenpkeallptgasmfveehvphaftaakgtgsakliav
nf

Timeline for d4j1xc2:

• d4j1xc2 first appeared in SCOPe 2.04
  
• d4j1xc2 appears in SCOPe 2.06
  
• d4j1xc2 appears in the current release, SCOPe 2.08