SCOP 1.65: Domain d1bqp.1: 1bqp A:,B:

Lineage for d1bqp.1 (1bqp A:,B:)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (15 families)

5. Family b.29.1.1: Legume lectins [49900] (4 proteins)

6. Protein Legume lectin [49904] (22 species)

7. Species Garden pea (Pisum sativum) [TaxId:3888] [49905] (6 PDB entries)
   two-chain protein resulted from a single-chain precursor

8. Domain d1bqp.1: 1bqp A:,B: [24028]

Details for d1bqp.1

PDB Entry: 1bqp, 2.1 Å

PDB Description: the structure of the pea lectin-d-mannopyranose complex

SCOP Domain Sequences for d1bqp.1:

Sequence; same for both SEQRES and ATOM records:

>g1bqp.1 b.29.1.1 (A:,B:) Legume lectin {Garden pea (Pisum sativum)}
tettsflitkfspdqqnlifqgdgyttkekltltkavkntvgralysspihiwdretgnv
anfvtsftfvinapnsynvadgftffiapvdtkpqtgggylgvfnsaeydkttqtvavef
dtfynaawdpsnrdrhigidvnsiksvntkswklqngeeanvviafnaatnvltvsltyp
nXvtsytlsdvvslkdvvpewvrigfsattgaeyaahevlswsfhsels

Timeline for d1bqp.1:

• d1bqp.1 first appeared (with stable ids) in SCOP 1.55
  
• d1bqp.1 appears in SCOP 1.63
  
• d1bqp.1 appears in SCOP 1.67
  
• d1bqp.1 appears in the current release, SCOPe 2.08