Lineage for d1bqp.1 (1bqp A:,B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2778276Family b.29.1.1: Legume lectins [49900] (5 proteins)
  6. 2778483Protein Legume lectin [49904] (23 species)
  7. 2778650Species Pea (Pisum sativum) [TaxId:3888] [49905] (6 PDB entries)
    two-chain protein resulted from a single-chain precursor
  8. 2778659Domain d1bqp.1: 1bqp A:,B: [24028]
    complexed with bma, ca, man, mn

Details for d1bqp.1

PDB Entry: 1bqp (more details), 2.1 Å

PDB Description: the structure of the pea lectin-d-mannopyranose complex
PDB Compounds: (A:) protein (lectin), (B:) protein (lectin)

SCOPe Domain Sequences for d1bqp.1:

Sequence; same for both SEQRES and ATOM records: (download)

>g1bqp.1 b.29.1.1 (A:,B:) Legume lectin {Pea (Pisum sativum) [TaxId: 3888]}
tettsflitkfspdqqnlifqgdgyttkekltltkavkntvgralysspihiwdretgnv
anfvtsftfvinapnsynvadgftffiapvdtkpqtgggylgvfnsaeydkttqtvavef
dtfynaawdpsnrdrhigidvnsiksvntkswklqngeeanvviafnaatnvltvsltyp
nXvtsytlsdvvslkdvvpewvrigfsattgaeyaahevlswsfhsels

SCOPe Domain Coordinates for d1bqp.1:

Click to download the PDB-style file with coordinates for d1bqp.1.
(The format of our PDB-style files is described here.)

Timeline for d1bqp.1: