| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily) core: 4 helices; folded leaf, closed |
Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) ![]() |
| Family a.35.1.3: SinR domain-like [47432] (9 proteins) |
| Protein Hydroxypropylphosphonic acid epoxidase Fom4, N-terminal domain [140516] (1 species) |
| Species Streptomyces wedmorensis [TaxId:43759] [140517] (14 PDB entries) Uniprot Q56185 6-76 |
| Domain d4j1xc1: 4j1x C:4-76 [240279] Other proteins in same PDB: d4j1xa2, d4j1xb2, d4j1xc2 automated match to d4j1xa1 complexed with 1jj, fe2, gol |
PDB Entry: 4j1x (more details), 2.8 Å
SCOPe Domain Sequences for d4j1xc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4j1xc1 a.35.1.3 (C:4-76) Hydroxypropylphosphonic acid epoxidase Fom4, N-terminal domain {Streptomyces wedmorensis [TaxId: 43759]}
tktastgfaellkdrreqvkmdhaalasllgetpetvaawengeggeltltqlgriahvl
gtsigaltppagn
Timeline for d4j1xc1:
View in 3DDomains from other chains: (mouse over for more information) d4j1xa1, d4j1xa2, d4j1xb1, d4j1xb2 |