Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like |
Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families) binds cofactor molecules in the opposite direction than classical Rossmann fold |
Family c.31.1.4: Transhydrogenase domain III (dIII) [52484] (2 proteins) binds NADP, shares with the pyruvate oxidase FAD-binding domain a common ADP-binding mode automatically mapped to Pfam PF02233 |
Protein automated matches [236540] (2 species) not a true protein |
Species Thermus thermophilus [TaxId:262724] [236542] (2 PDB entries) |
Domain d4j1tc_: 4j1t C: [240276] automated match to d4j1tf_ complexed with gol, nad, nap |
PDB Entry: 4j1t (more details), 2.37 Å
SCOPe Domain Sequences for d4j1tc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4j1tc_ c.31.1.4 (C:) automated matches {Thermus thermophilus [TaxId: 262724]} kgslkpidvedaavmlayagkvvfvpgygmalsqaqhklkeladlleargvevkfaihpv agrmpghmnvllaeagvdydklkdleeinpefptvdvavvigandvvnpaarrpgsplyg mpildvdkaknvivikrgqgkgfagvenelfyaentrmlygdaqkvlteliqalkrl
Timeline for d4j1tc_: