Class a: All alpha proteins [46456] (285 folds) |
Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily) multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry |
Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) N-terminal domain is Rossmann-fold with a family-specific C-terminal extension |
Family a.100.1.0: automated matches [227147] (1 protein) not a true family |
Protein automated matches [226851] (26 species) not a true protein |
Species Nematode (Caenorhabditis elegans) [TaxId:6239] [237814] (2 PDB entries) |
Domain d4j0ea2: 4j0e A:199-296 [240275] Other proteins in same PDB: d4j0ea1, d4j0eb1 automated match to d4j0eb2 |
PDB Entry: 4j0e (more details), 1.6 Å
SCOPe Domain Sequences for d4j0ea2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4j0ea2 a.100.1.0 (A:199-296) automated matches {Nematode (Caenorhabditis elegans) [TaxId: 6239]} gfivnrllipyffeaarmyergdasmtdideamklgaghpmgpfeladyigldtvkfvmd gwaakypevqlfeasplvdklvaegklgrktgdgfysy
Timeline for d4j0ea2: