SCOPe 2.08: Domain d4j0ea2: 4j0e A:199-296

Lineage for d4j0ea2 (4j0e A:199-296)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
   multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry

4. Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families)
   N-terminal domain is Rossmann-fold with a family-specific C-terminal extension

5. Family a.100.1.0: automated matches [227147] (1 protein)
   not a true family

6. Protein automated matches [226851] (46 species)
   not a true protein

7. Species Nematode (Caenorhabditis elegans) [TaxId:6239] [237814] (2 PDB entries)

8. Domain d4j0ea2: 4j0e A:199-296 [240275]
   Other proteins in same PDB: d4j0ea1, d4j0eb1
   automated match to d4j0eb2

Details for d4j0ea2

PDB Entry: 4j0e, 1.6 Å

PDB Description: Crystal structure of 3-hydroxyacyl-CoA dehydrogenase from Caenorhadbitis elegans in P1 space group

PDB Compounds: (A:) Probable 3-hydroxyacyl-CoA dehydrogenase F54C8.1

SCOPe Domain Sequences for d4j0ea2:

Sequence; same for both SEQRES and ATOM records:

>d4j0ea2 a.100.1.0 (A:199-296) automated matches {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
gfivnrllipyffeaarmyergdasmtdideamklgaghpmgpfeladyigldtvkfvmd
gwaakypevqlfeasplvdklvaegklgrktgdgfysy

Timeline for d4j0ea2:

• d4j0ea2 first appeared in SCOPe 2.04
  
• d4j0ea2 appears in SCOPe 2.07