| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
| Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
| Protein automated matches [190069] (309 species) not a true protein |
| Species Nematode (Caenorhabditis elegans) [TaxId:6239] [237812] (4 PDB entries) |
| Domain d4j0ea1: 4j0e A:1-198 [240274] Other proteins in same PDB: d4j0ea2, d4j0eb2 automated match to d4j0eb1 |
PDB Entry: 4j0e (more details), 1.6 Å
SCOPe Domain Sequences for d4j0ea1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4j0ea1 c.2.1.0 (A:1-198) automated matches {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
mftakcamqnirnvaivgsgqmgsgiaqvtassgfnvmladvnkkaldramkaisqsvth
lskkqkgtdkeksdfvtltmsriktcnnvstavadadliieaaienidlkrgifaqieqs
ckkdsilttntssflledvakglqdktrfgglhffnpvpvmkllevirsddtsdetyatl
ikfgtavgkttvackdsp
Timeline for d4j0ea1: