![]() | Class a: All alpha proteins [46456] (285 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.6: C-terminal effector domain of the bipartite response regulators [46894] (4 families) ![]() binds to DNA and RNA polymerase; the N-terminal, receiver domain belongs to the CheY family |
![]() | Family a.4.6.0: automated matches [191513] (1 protein) not a true family |
![]() | Protein automated matches [190858] (12 species) not a true protein |
![]() | Species Staphylococcus epidermidis [TaxId:176280] [236417] (1 PDB entry) |
![]() | Domain d4ixaa_: 4ixa A: [240272] automated match to d4ixab_ |
PDB Entry: 4ixa (more details), 2.15 Å
SCOPe Domain Sequences for d4ixaa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ixaa_ a.4.6.0 (A:) automated matches {Staphylococcus epidermidis [TaxId: 176280]} meqlefdglvlknlsktltinnieipmrikefellwylasregevisksellekvwgydy yedantvnvhihrireklekhdflpytittvwglgykfersr
Timeline for d4ixaa_: