Lineage for d2bqpb_ (2bqp B:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2042196Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2042197Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2042198Family b.29.1.1: Legume lectins [49900] (5 protein domains)
  6. 2042364Protein Legume lectin [49904] (23 species)
  7. 2042527Species Pea (Pisum sativum) [TaxId:3888] [49905] (6 PDB entries)
    two-chain protein resulted from a single-chain precursor
  8. 2042533Domain d2bqpb_: 2bqp B: [24027]
    complexed with ca, glc, mn

Details for d2bqpb_

PDB Entry: 2bqp (more details), 1.9 Å

PDB Description: the structure of the pea lectin-d-glucopyranose complex
PDB Compounds: (B:) protein (pea lectin)

SCOPe Domain Sequences for d2bqpb_:

Sequence, based on SEQRES records: (download)

>d2bqpb_ b.29.1.1 (B:) Legume lectin {Pea (Pisum sativum) [TaxId: 3888]}
tettsflitkfspdqqnlifqgdgyttkekltltkavkntvgralysspihiwdretgnv
anfvtsftfvinapnsynvadgftffiapvdtkpqtgggylgvfnsaeydkttqtvavef
dtfynaawdpsnrdrhigidvnsiksvntkswklqngeeanvviafnaatnvltvsltyp
nnsleeevtsytlsdvvslkdvvpewvrigfsattgaeyaahevlswsfhsels

Sequence, based on observed residues (ATOM records): (download)

>d2bqpb_ b.29.1.1 (B:) Legume lectin {Pea (Pisum sativum) [TaxId: 3888]}
tettsflitkfspdqqnlifqgdgyttkekltltkavkntvgralysspihiwdretgnv
anfvtsftfvinapnsynvadgftffiapvdtkpqtgggylgvfnsaeydkttqtvavef
dtfynaawdpsnrdrhigidvnsiksvntkswklqngeeanvviafnaatnvltvsltyp
nvtsytlsdvvslkdvvpewvrigfsattgaeyaahevlswsfhsels

SCOPe Domain Coordinates for d2bqpb_:

Click to download the PDB-style file with coordinates for d2bqpb_.
(The format of our PDB-style files is described here.)

Timeline for d2bqpb_: