![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
![]() | Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
![]() | Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
![]() | Protein automated matches [190056] (195 species) not a true protein |
![]() | Species Lodderomyces elongisporus [TaxId:379508] [234906] (1 PDB entry) |
![]() | Domain d4ivff1: 4ivf F:5-94 [240264] Other proteins in same PDB: d4ivfa2, d4ivfb2, d4ivfc2, d4ivfc3, d4ivfd2, d4ivfe2, d4ivfe3, d4ivff2, d4ivff3, d4ivfg2, d4ivfg3, d4ivfh2 automated match to d4ivfb1 complexed with cit, gsh |
PDB Entry: 4ivf (more details), 2.2 Å
SCOPe Domain Sequences for d4ivff1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ivff1 c.47.1.0 (F:5-94) automated matches {Lodderomyces elongisporus [TaxId: 379508]} lkpiklytaptpngykisiflevlgldyevqkfdlsknetkedwfvklnpngriptindp nfkgvdgglvlsqtgailqyladtydkehk
Timeline for d4ivff1: