Lineage for d4ivfe2 (4ivf E:95-224)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2712830Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 2712831Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 2713795Family a.45.1.0: automated matches [227130] (1 protein)
    not a true family
  6. 2713796Protein automated matches [226831] (73 species)
    not a true protein
  7. 2714062Species Lodderomyces elongisporus [TaxId:379508] [234908] (1 PDB entry)
  8. 2714066Domain d4ivfe2: 4ivf E:95-224 [240263]
    Other proteins in same PDB: d4ivfa1, d4ivfa2, d4ivfb1, d4ivfc1, d4ivfc3, d4ivfd1, d4ivfe1, d4ivfe3, d4ivff1, d4ivff3, d4ivfg1, d4ivfg3, d4ivfh1
    automated match to d4ivfb2
    complexed with cit, gsh

Details for d4ivfe2

PDB Entry: 4ivf (more details), 2.2 Å

PDB Description: crystal structure of glutathione transferase homolog from lodderomyces elongisporus, target efi-501753, with two gsh per subunit
PDB Compounds: (E:) Putative uncharacterized protein

SCOPe Domain Sequences for d4ivfe2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ivfe2 a.45.1.0 (E:95-224) automated matches {Lodderomyces elongisporus [TaxId: 379508]}
fsypagtaeyyktleylifqvaengpiqgqanhfvfaakekvpyginryitdtkriygvf
edilsrnkandskylvgdrytvadfallgwayrlsrleidinqwpllgkwydsllklpav
qkgfevppkn

SCOPe Domain Coordinates for d4ivfe2:

Click to download the PDB-style file with coordinates for d4ivfe2.
(The format of our PDB-style files is described here.)

Timeline for d4ivfe2: