Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
Protein automated matches [190056] (147 species) not a true protein |
Species Lodderomyces elongisporus [TaxId:379508] [234906] (1 PDB entry) |
Domain d4ivfc1: 4ivf C:5-94 [240258] Other proteins in same PDB: d4ivfb2, d4ivfc2, d4ivfd2, d4ivfe2, d4ivff2, d4ivfg2, d4ivfh2 automated match to d4ivfb1 complexed with cit, gsh |
PDB Entry: 4ivf (more details), 2.2 Å
SCOPe Domain Sequences for d4ivfc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ivfc1 c.47.1.0 (C:5-94) automated matches {Lodderomyces elongisporus [TaxId: 379508]} lkpiklytaptpngykisiflevlgldyevqkfdlsknetkedwfvklnpngriptindp nfkgvdgglvlsqtgailqyladtydkehk
Timeline for d4ivfc1: