| Class b: All beta proteins [48724] (180 folds) |
| Fold b.21: Virus attachment protein globular domain [49834] (1 superfamily) sandwich, 10 strands in 2 sheets; greek-key |
Superfamily b.21.1: Virus attachment protein globular domain [49835] (4 families) ![]() |
| Family b.21.1.3: Lactophage receptor-binding protein head domain [141122] (3 proteins) automatically mapped to Pfam PF08932 |
| Protein automated matches [232461] (1 species) not a true protein |
| Species Lactococcus phage [TaxId:35345] [232462] (6 PDB entries) |
| Domain d4iosh_: 4ios H: [240251] Other proteins in same PDB: d4iosd_, d4iose_, d4iosf_, d4iosg_ automated match to d3hg0a1 complexed with gol |
PDB Entry: 4ios (more details), 2.4 Å
SCOPe Domain Sequences for d4iosh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4iosh_ b.21.1.3 (H:) automated matches {Lactococcus phage [TaxId: 35345]}
tkswsgelgggiilslrkkgttveysiggeisssilansnlvnrsvpnefcprnrcslvg
hmvggwnafhidipssgvcqwfgptassgtprgtgtypid
Timeline for d4iosh_: