Lineage for d2ltn.2 (2ltn C:,D:)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 108496Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
  4. 108497Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (12 families) (S)
  5. 108498Family b.29.1.1: Legume lectins [49900] (4 proteins)
  6. 108607Protein Legume lectin [49904] (19 species)
  7. 108659Species Garden pea (Pisum sativum) [TaxId:3888] [49905] (4 PDB entries)
  8. 108661Domain d2ltn.2: 2ltn C:,D: [24025]

Details for d2ltn.2

PDB Entry: 2ltn (more details), 1.7 Å

PDB Description: design, expression, and crystallization of recombinant lectin from the garden pea (pisum sativum)

SCOP Domain Sequences for d2ltn.2:

Sequence; same for both SEQRES and ATOM records: (download)

>g2ltn.2 b.29.1.1 (C:,D:) Legume lectin {Garden pea (Pisum sativum)}
tettsflitkfspdqqnlifqgdgyttkekltltkavkntvgralysspihiwdretgnv
anfvtsftfvinapnsynvadgftffiapvdtkpqtgggylgvfnsaeydkttqtvavef
dtfynaawdpsnrdrhigidvnsiksvntkswklqngeeanvviafnaatnvltvsltyp
nXvtsytlsdvvslkdvvpewvrigfsattgaeyaahevlswsfhselsg

SCOP Domain Coordinates for d2ltn.2:

Click to download the PDB-style file with coordinates for d2ltn.2.
(The format of our PDB-style files is described here.)

Timeline for d2ltn.2: