Lineage for d4iosa_ (4ios A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2776827Fold b.21: Virus attachment protein globular domain [49834] (1 superfamily)
    sandwich, 10 strands in 2 sheets; greek-key
  4. 2776828Superfamily b.21.1: Virus attachment protein globular domain [49835] (4 families) (S)
  5. 2777048Family b.21.1.3: Lactophage receptor-binding protein head domain [141122] (3 proteins)
    automatically mapped to Pfam PF08932
  6. 2777065Protein automated matches [232461] (1 species)
    not a true protein
  7. 2777066Species Lactococcus phage [TaxId:35345] [232462] (6 PDB entries)
  8. 2777093Domain d4iosa_: 4ios A: [240248]
    Other proteins in same PDB: d4iosd_, d4iose_, d4iosf_, d4iosg_
    automated match to d3hg0a1
    complexed with gol

Details for d4iosa_

PDB Entry: 4ios (more details), 2.4 Å

PDB Description: structure of phage tp901-1 rbp (orf49) in complex with nanobody 11.
PDB Compounds: (A:) bpp

SCOPe Domain Sequences for d4iosa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4iosa_ b.21.1.3 (A:) automated matches {Lactococcus phage [TaxId: 35345]}
tkswsgelgggiilslrkkgttveysiggeisssilansnlvnrsvpnefcprnrcslvg
hmvggwnafhidipssgvcqwfgptassgtprgtgtypid

SCOPe Domain Coordinates for d4iosa_:

Click to download the PDB-style file with coordinates for d4iosa_.
(The format of our PDB-style files is described here.)

Timeline for d4iosa_: