![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.74: Cyclin-like [47953] (1 superfamily) core: 5 helices; one helix is surrounded by the others |
![]() | Superfamily a.74.1: Cyclin-like [47954] (4 families) ![]() duplication: consists of two domains of this fold |
![]() | Family a.74.1.1: Cyclin [47955] (9 proteins) |
![]() | Protein Cyclin T1 [158595] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [158596] (10 PDB entries) Uniprot O60563 151-259! Uniprot O60563 151-263! Uniprot O60563 5-150! Uniprot O60563 8-150 |
![]() | Domain d4imyf1: 4imy F:8-150 [240242] Other proteins in same PDB: d4imya_, d4imyc_, d4imye_ automated match to d4imyb1 complexed with amp |
PDB Entry: 4imy (more details), 2.94 Å
SCOPe Domain Sequences for d4imyf1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4imyf1 a.74.1.1 (F:8-150) Cyclin T1 {Human (Homo sapiens) [TaxId: 9606]} nnkrwyftreqlenspsrrfgvdpdkelsyrqqaanllqdmgqrlnvsqltintaivymh rfymiqsftqfpgnsvapaalflaakveeqpkklehvikvahtclhpqeslpdtrseayl qqvqdlvilesiilqtlgfelti
Timeline for d4imyf1: