![]() | Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
![]() | Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
![]() | Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) ![]() shares functional and structural similarities with the ATP-grasp fold and PIPK |
![]() | Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins) members organized in the groups and subfamiles specified by the comments |
![]() | Protein automated matches [190091] (12 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [188447] (553 PDB entries) |
![]() | Domain d4imye_: 4imy E: [240241] Other proteins in same PDB: d4imyb1, d4imyb2, d4imyd1, d4imyd2, d4imyf1, d4imyf2 automated match to d4imya_ complexed with amp |
PDB Entry: 4imy (more details), 2.94 Å
SCOPe Domain Sequences for d4imye_:
Sequence, based on SEQRES records: (download)
>d4imye_ d.144.1.7 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]} vecpfcdevskyeklakigqgtfgevfkarhrktgqkvalkkvlmenekegfpitalrei kilqllkhenvvnlieicrtkaspynrckgsiylvfdfcehdlagllsnvlvkftlseik rvmqmllnglyyihrnkilhrdmkaanvlitrdgvlkladfglarafslaknsqpnrytn rvvtlwyrppelllgerdygppidlwgagcimaemwtrspimqgnteqhqlalisqlcgs itpevwpnvdnyelyeklelvkgqkrkvkdrlkayvrdpyaldlidkllvldpaqridsd dalnhdffwsdpmpsdlkgmlst
>d4imye_ d.144.1.7 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]} vecpfcdevskyeklakigqgtfgevfkarhrktgqkvalkkvlmenekegfpitalrei kilqllkhenvvnlieicrtksiylvfdfcehdlagllsnvlvkftlseikrvmqmllng lyyihrnkilhrdmkaanvlitrdgvlkladfglarafslaknsqpnrytnrvvtlwyrp pelllgerdygppidlwgagcimaemwtrspimqgnteqhqlalisqlcgsitpevwpnv dnyelyeklelvkgqkrkvkdrlkayvrdpyaldlidkllvldpaqridsddalnhdffw sdpmpsdlkgmlst
Timeline for d4imye_: