Lineage for d4imye_ (4imy E:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542179Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2542180Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2542316Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2545120Protein automated matches [190091] (19 species)
    not a true protein
  7. 2545220Species Human (Homo sapiens) [TaxId:9606] [188447] (741 PDB entries)
  8. 2545794Domain d4imye_: 4imy E: [240241]
    Other proteins in same PDB: d4imyb1, d4imyb2, d4imyd1, d4imyd2, d4imyf1, d4imyf2
    automated match to d4imya_
    complexed with amp

Details for d4imye_

PDB Entry: 4imy (more details), 2.94 Å

PDB Description: The AFF4 scaffold binds human P-TEFb adjacent to HIV Tat
PDB Compounds: (E:) Cyclin-dependent kinase 9

SCOPe Domain Sequences for d4imye_:

Sequence, based on SEQRES records: (download)

>d4imye_ d.144.1.7 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vecpfcdevskyeklakigqgtfgevfkarhrktgqkvalkkvlmenekegfpitalrei
kilqllkhenvvnlieicrtkaspynrckgsiylvfdfcehdlagllsnvlvkftlseik
rvmqmllnglyyihrnkilhrdmkaanvlitrdgvlkladfglarafslaknsqpnrytn
rvvtlwyrppelllgerdygppidlwgagcimaemwtrspimqgnteqhqlalisqlcgs
itpevwpnvdnyelyeklelvkgqkrkvkdrlkayvrdpyaldlidkllvldpaqridsd
dalnhdffwsdpmpsdlkgmlst

Sequence, based on observed residues (ATOM records): (download)

>d4imye_ d.144.1.7 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vecpfcdevskyeklakigqgtfgevfkarhrktgqkvalkkvlmenekegfpitalrei
kilqllkhenvvnlieicrtksiylvfdfcehdlagllsnvlvkftlseikrvmqmllng
lyyihrnkilhrdmkaanvlitrdgvlkladfglarafslaknsqpnrytnrvvtlwyrp
pelllgerdygppidlwgagcimaemwtrspimqgnteqhqlalisqlcgsitpevwpnv
dnyelyeklelvkgqkrkvkdrlkayvrdpyaldlidkllvldpaqridsddalnhdffw
sdpmpsdlkgmlst

SCOPe Domain Coordinates for d4imye_:

Click to download the PDB-style file with coordinates for d4imye_.
(The format of our PDB-style files is described here.)

Timeline for d4imye_: