Lineage for d4imyd2 (4imy D:151-257)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1739685Fold a.74: Cyclin-like [47953] (1 superfamily)
    core: 5 helices; one helix is surrounded by the others
  4. 1739686Superfamily a.74.1: Cyclin-like [47954] (4 families) (S)
    duplication: consists of two domains of this fold
  5. 1739687Family a.74.1.1: Cyclin [47955] (9 proteins)
  6. 1740045Protein Cyclin T1 [158595] (1 species)
  7. 1740046Species Human (Homo sapiens) [TaxId:9606] [158596] (10 PDB entries)
    Uniprot O60563 151-259! Uniprot O60563 151-263! Uniprot O60563 5-150! Uniprot O60563 8-150
  8. 1740062Domain d4imyd2: 4imy D:151-257 [240240]
    Other proteins in same PDB: d4imya_, d4imyc_, d4imye_
    automated match to d4imyb2
    complexed with amp

Details for d4imyd2

PDB Entry: 4imy (more details), 2.94 Å

PDB Description: The AFF4 scaffold binds human P-TEFb adjacent to HIV Tat
PDB Compounds: (D:) Cyclin-T1

SCOPe Domain Sequences for d4imyd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4imyd2 a.74.1.1 (D:151-257) Cyclin T1 {Human (Homo sapiens) [TaxId: 9606]}
dhphthvvkctqlvraskdlaqtsyfmatnslhlttfslqytppvvacvcihlackwsnw
eipvstdgkhwweyvdatvtlelldeltheflqilektpnrlkriwn

SCOPe Domain Coordinates for d4imyd2:

Click to download the PDB-style file with coordinates for d4imyd2.
(The format of our PDB-style files is described here.)

Timeline for d4imyd2: