Lineage for d2ltn.1 (2ltn A:,B:)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 226527Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 226528Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (15 families) (S)
  5. 226529Family b.29.1.1: Legume lectins [49900] (4 proteins)
  6. 226650Protein Legume lectin [49904] (22 species)
  7. 226716Species Garden pea (Pisum sativum) [TaxId:3888] [49905] (4 PDB entries)
    two-chain protein resulted from a single-chain precursor
  8. 226717Domain d2ltn.1: 2ltn A:,B: [24024]

Details for d2ltn.1

PDB Entry: 2ltn (more details), 1.7 Å

PDB Description: design, expression, and crystallization of recombinant lectin from the garden pea (pisum sativum)

SCOP Domain Sequences for d2ltn.1:

Sequence; same for both SEQRES and ATOM records: (download)

>g2ltn.1 b.29.1.1 (A:,B:) Legume lectin {Garden pea (Pisum sativum)}
tettsflitkfspdqqnlifqgdgyttkekltltkavkntvgralysspihiwdretgnv
anfvtsftfvinapnsynvadgftffiapvdtkpqtgggylgvfnsaeydkttqtvavef
dtfynaawdpsnrdrhigidvnsiksvntkswklqngeeanvviafnaatnvltvsltyp
nXvtsytlsdvvslkdvvpewvrigfsattgaeyaahevlswsfhselsg

SCOP Domain Coordinates for d2ltn.1:

Click to download the PDB-style file with coordinates for d2ltn.1.
(The format of our PDB-style files is described here.)

Timeline for d2ltn.1: