Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (31 species) not a true protein |
Species Cow (Bos taurus) [TaxId:9913] [226022] (18 PDB entries) |
Domain d4iiqc3: 4iiq C:292-385 [240237] Other proteins in same PDB: d4iiqa2, d4iiqb2, d4iiqc2 automated match to d2xfxa2 complexed with so4 |
PDB Entry: 4iiq (more details), 2.86 Å
SCOPe Domain Sequences for d4iiqc3:
Sequence, based on SEQRES records: (download)
>d4iiqc3 b.1.1.0 (C:292-385) automated matches {Cow (Bos taurus) [TaxId: 9913]} teppkvrvnhketfpgittlycraygfyppeisinwmkngeeifqdtdyggilpsgdgty qtwvsveldpqngdiyschvehggvhmvlqgfqe
>d4iiqc3 b.1.1.0 (C:292-385) automated matches {Cow (Bos taurus) [TaxId: 9913]} teppkvrvnhkttlycraygfyppeisinwmkngeeifqdtdyggilpsgdgtyqtwvsv elqngdiyschvehggvhmvlqgfqe
Timeline for d4iiqc3:
View in 3D Domains from other chains: (mouse over for more information) d4iiqa1, d4iiqa2, d4iiqb1, d4iiqb2 |