Lineage for d4iiqc1 (4iiq C:1-95)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1519111Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1519112Protein automated matches [190740] (19 species)
    not a true protein
  7. 1519154Species Cow (Bos taurus) [TaxId:9913] [226022] (4 PDB entries)
  8. 1519164Domain d4iiqc1: 4iiq C:1-95 [240235]
    Other proteins in same PDB: d4iiqa2, d4iiqb2, d4iiqc2
    automated match to d2xfxa2
    complexed with so4

Details for d4iiqc1

PDB Entry: 4iiq (more details), 2.86 Å

PDB Description: crystal structure of a human mait tcr in complex with bovine mr1
PDB Compounds: (C:) Beta-2-microglobulin, MHC class I-related protein

SCOPe Domain Sequences for d4iiqc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4iiqc1 b.1.1.0 (C:1-95) automated matches {Cow (Bos taurus) [TaxId: 9913]}
iqrppkiqvysrhppedgkpnylncyvygfhppqieidllkngekikseqsdlsfskdws
fyllshaeftpnskdqyscrvkhvtleqprivkwd

SCOPe Domain Coordinates for d4iiqc1:

Click to download the PDB-style file with coordinates for d4iiqc1.
(The format of our PDB-style files is described here.)

Timeline for d4iiqc1: